Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLN5 Peptide - C-terminal region

CLN5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NCL

UniProt

O75503

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLN5 Rabbit Polyclonal Antibody (orb584537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006484

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adck2 ORF Vector (Mouse) (pORF)
11386014 1.0 µg DNA

Adck2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
LARG Rabbit pAb, BF700 conjugated
orb2877759 100 µL

LARG Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse Cytoplasmic tyrosine protein kinase BMX (BMX) ELISA kit
GTR10436791 96 Well

Mouse Cytoplasmic tyrosine protein kinase BMX (BMX) ELISA kit

Sign In for Pricing
View Details
MRPL53P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV770921 1.0 µg DNA

MRPL53P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
HNF4G antibody
FNab03943 100 µg

HNF4G antibody

Sign In for Pricing
View Details
SLC5A1 Antibody
orb674480-01 50 µg

SLC5A1 Antibody

Sign In for Pricing
View Details