Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLN5 Peptide - C-terminal region

CLN5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NCL

UniProt

O75503

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLN5 Rabbit Polyclonal Antibody (orb584537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006484

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD1a Antibody (703217) [Janelia Fluor 669]
FAB7076JF669 0.1 mL

Mouse Monoclonal CD1a Antibody (703217) [Janelia Fluor 669]

Sign In for Pricing
View Details
Anti-ZAP70 Antibody Picoband® (Cy3 Conjugate)
PB9968-Cy3 100 µg/Vial

Anti-ZAP70 Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
AppNHp (10 mg)
JBS-NU-407-10 10 mg

AppNHp (10 mg)

Sign In for Pricing
View Details
CSN1S1 ELISA Kit (Bovine)
OKCD05288-96W 96 Well

CSN1S1 ELISA Kit (Bovine)

Sign In for Pricing
View Details
Anti-Human MCP-1
GWB-BIG67D 500 µg

Anti-Human MCP-1

Sign In for Pricing
View Details
ATPBD4 (DPH6) Human Over-expression Lysate
orb1372634 20 µg

ATPBD4 (DPH6) Human Over-expression Lysate

Sign In for Pricing
View Details