Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNNM4 Peptide - middle region

CNNM4 Peptide - middle region

Product Specifications

Product Name Alternative

ACDP4

UniProt

Q6P4Q7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNNM4 Rabbit Polyclonal Antibody (orb588236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064569.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVTLEDVIEEIIKSEILDESDMYTDNRSRKRVSEKNKRDFSAFKDADNEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MYPT1 (Ser509) Antibody
MBS9610467-01 0.05 mL

Phospho-MYPT1 (Ser509) Antibody

Sign In for Pricing
View Details
Phospho-MYPT1 (Ser509) Antibody
MBS9610467-02 0.1 mL

Phospho-MYPT1 (Ser509) Antibody

Sign In for Pricing
View Details
Phospho-MYPT1 (Ser509) Antibody
MBS9610467-03 0.2 mL

Phospho-MYPT1 (Ser509) Antibody

Sign In for Pricing
View Details
Phospho-MYPT1 (Ser509) Antibody
MBS9610467-04 5x 0.2 mL

Phospho-MYPT1 (Ser509) Antibody

Sign In for Pricing
View Details
TRNAM20 Protein Vector (Human) (pPB-C-His)
PV139502 500 ng

TRNAM20 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Cytochrome c6, chloroplastic (petJ)
MBS1345082-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Cytochrome c6, chloroplastic (petJ)

Sign In for Pricing
View Details