CNNM4 Peptide - middle region
CNNM4 Peptide - middle region
Product Specifications
Product Name Alternative
ACDP4
UniProt
Q6P4Q7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CNNM4 Rabbit Polyclonal Antibody (orb588236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064569.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVTLEDVIEEIIKSEILDESDMYTDNRSRKRVSEKNKRDFSAFKDADNEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDMH100332-01 20 µg
Recombinant Human G-CSF R/CD114 Protein (His Tag)
Sign In for Pricing
View Details PDMH100332-02 100 µg
Recombinant Human G-CSF R/CD114 Protein (His Tag)
Sign In for Pricing
View Details PDMH100332-03 500 µg
Recombinant Human G-CSF R/CD114 Protein (His Tag)
Sign In for Pricing
View Details PDMH100332-04 1 mg
Recombinant Human G-CSF R/CD114 Protein (His Tag)
Sign In for Pricing
View Details 
MBS6188657-01 0.1 mL
YEATS4 (YEATS4, GAS41, YEATS domain-containing protein 4, Glioma-amplified sequence 41, NuMA-binding protein 1) (MaxLight 405)
Sign In for Pricing
View Details MBS6188657-02 5x 0.1 mL
YEATS4 (YEATS4, GAS41, YEATS domain-containing protein 4, Glioma-amplified sequence 41, NuMA-binding protein 1) (MaxLight 405)
Sign In for Pricing
View Details