Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGT Peptide - middle region

PIGT Peptide - middle region

Product Specifications

Product Name Alternative

NDAP, PNH2, CGI-06, MCAHS3

UniProt

Q969N2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGT Rabbit Polyclonal Antibody (orb588336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171657.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITSKGKENKPSYIHYQPAQDRLQPHLLEMLIQLPANSVTKVSIQFERALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naga Rabbit Polyclonal Antibody
TA362971 100 µL

Naga Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human NKD2 activation kit by CRISPRa
GA113873 1 Kit

Human NKD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Smooth Muscle Actin (1A4), Biotin conjugate, 0.1mg/mL
BNCB0665-100 1x 100 µL

Smooth Muscle Actin (1A4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TH1L (NELFCD) (NM_198976) Human Recombinant Protein
TP304842M 100 µg

TH1L (NELFCD) (NM_198976) Human Recombinant Protein

Sign In for Pricing
View Details
Fluo-8H™, AM
21091-AAT 10x 50 µg

Fluo-8H™, AM

Sign In for Pricing
View Details
Usp10 Mouse Gene Knockout Kit (CRISPR)
KN518765 1 Kit

Usp10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details