RBBP4 Peptide - C-terminal region
RBBP4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
NURF55, RBAP48, lin-53
UniProt
Q09028
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RBBP4 Rabbit Polyclonal Antibody (orb588344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001128727.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Emerin Recombinant Rabbit Monoclonal Antibody [PSH01-85]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81a1f/imageurl/ha721743.webp)
HA721743 100 µL
Emerin Recombinant Rabbit Monoclonal Antibody [PSH01-85]
Sign In for Pricing
View Details 
