Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP4 Peptide - C-terminal region

RBBP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NURF55, RBAP48, lin-53

UniProt

Q09028

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBBP4 Rabbit Polyclonal Antibody (orb588344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128727.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Interleukin-16/IL-16 Protein
PKSH032618-01 10 µg

Recombinant Human Interleukin-16/IL-16 Protein

Sign In for Pricing
View Details
Recombinant Human Interleukin-16/IL-16 Protein
PKSH032618-02 50 µg

Recombinant Human Interleukin-16/IL-16 Protein

Sign In for Pricing
View Details
Anti-PTPN12
Y058451 100 µL

Anti-PTPN12

Sign In for Pricing
View Details
Human AP4 (REPIN1) activation kit by CRISPRa
GA109277 1 Kit

Human AP4 (REPIN1) activation kit by CRISPRa

Sign In for Pricing
View Details
4-Nitrobenzeneethanesulfonic Acid
TRC-N493280-5G 5 g

4-Nitrobenzeneethanesulfonic Acid

Sign In for Pricing
View Details
rac-2,3-Dimercaptosuccinic Acid
TRC-D555620-25MG 25 mg

rac-2,3-Dimercaptosuccinic Acid

Sign In for Pricing
View Details