RRM2 Peptide - middle region
RRM2 Peptide - middle region
Product Specifications
Product Name Alternative
R2, RR2, RR2M
UniProt
P31350
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RRM2 Rabbit Polyclonal Antibody (orb588349) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001025.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP50599_P050-HRP 100 µL
Senp6 Antibody - C-terminal region : HRP (ARP50599_P050-HRP)
Sign In for Pricing
View Details 