Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK8IP1 Peptide - N-terminal region

MAPK8IP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IB1, JIP1, JIP-1, PRKM8IP

UniProt

Q9UQF2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK8IP1 Rabbit Polyclonal Antibody (orb588459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005447.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR pTyr1110 Rabbit Polyclonal Antibody
AP20868PU-N 100 µg

EGFR pTyr1110 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS803481 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
BLM (1319-1335) Rabbit Polyclonal Antibody
AP07900PU-N 50 µg

BLM (1319-1335) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS503335 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Human BEND6 activation kit by CRISPRa
GA116609 1 Kit

Human BEND6 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin, multi (C11), 0.2mg/mL
BNUB0393-100 1x 100 µL

Cytokeratin, multi (C11), 0.2mg/mL

Sign In for Pricing
View Details