Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK8IP1 Peptide - N-terminal region

MAPK8IP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IB1, JIP1, JIP-1, PRKM8IP

UniProt

Q9UQF2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK8IP1 Rabbit Polyclonal Antibody (orb588459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005447.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C17orf87 (SCIMP) activation kit by CRISPRa
GA117942 1 Kit

Human C17orf87 (SCIMP) activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-
BA-7401-2 2 mg

Biotin Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-

Sign In for Pricing
View Details
Uqcc3 Mouse Gene Knockout Kit (CRISPR)
KN501024 1 Kit

Uqcc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE3B Human Gene Knockout Kit (CRISPR)
KN419619 1 Kit

PDE3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FABP6 (NM_001040442) Human Recombinant Protein
TP720196M 50 µg

FABP6 (NM_001040442) Human Recombinant Protein

Sign In for Pricing
View Details
Human DEFB134 activation kit by CRISPRa
GA118644 1 Kit

Human DEFB134 activation kit by CRISPRa

Sign In for Pricing
View Details