MSL3 Peptide - C-terminal region
MSL3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MSL3L1
UniProt
Q8N5Y2
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MSL3 Rabbit Polyclonal Antibody (orb588474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_523353
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1143658-01 0.5 mg (E-Coli)
Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S)
Sign In for Pricing
View Details MBS1143658-02 0.05 mg (Baculovirus)
Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S)
Sign In for Pricing
View Details MBS1143658-03 0.05 mg (Mammalian-Cell)
Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S)
Sign In for Pricing
View Details MBS1143658-04 0.5 mg (Yeast)
Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S)
Sign In for Pricing
View Details MBS1143658-05 1 mg (E-Coli)
Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S)
Sign In for Pricing
View Details