Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNW1 Peptide - C-terminal region

SNW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bx42, SKIP, Prp45, SKIIP, PRPF45, NCOA-62

UniProt

Q13573

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNW1 Rabbit Polyclonal Antibody (orb588481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036377.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLPP1 Rabbit Polyclonal Antibody
55603-01 50 µL

PHLPP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PHLPP1 Rabbit Polyclonal Antibody
55603-02 100 µL

PHLPP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IST1 Protein, N-His
MBS1576740-01 0.1 mg

Recombinant Human IST1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IST1 Protein, N-His
MBS1576740-02 1 mg

Recombinant Human IST1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IST1 Protein, N-His
MBS1576740-03 5x 1 mg

Recombinant Human IST1 Protein, N-His

Sign In for Pricing
View Details
Human GAGE5 (NM_001475) AAV Particle
RC212463A1V 250 µL

Human GAGE5 (NM_001475) AAV Particle

Sign In for Pricing
View Details