Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNW1 Peptide - C-terminal region

SNW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bx42, SKIP, Prp45, SKIIP, PRPF45, NCOA-62

UniProt

Q13573

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNW1 Rabbit Polyclonal Antibody (orb588481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036377.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TR4 siRNA (m)
sc-38895 10 µM

TR4 siRNA (m)

Sign In for Pricing
View Details
G6b sgRNA CRISPR Lentivector set (Rat)
K6304201 3x 1.0 µg

G6b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Human Sulfatase 1 (SULF1) ELISA Kit
EKN48603 96 Tests

Human Sulfatase 1 (SULF1) ELISA Kit

Sign In for Pricing
View Details
Anti-FCGRT Antibody Picoband® Fluoro488 Conjugated
PB9866-Fluoro488 100 µg/Vial

Anti-FCGRT Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
HIST1H2BM Protein Lysate (Rat) with C-HA Tag
23347036 100 µg

HIST1H2BM Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
MKI67IP CRISPRa sgRNA lentivector (set of three targets)(Mouse)
30164124 3x 1.0µg DNA

MKI67IP CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details