Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNW1 Peptide - C-terminal region

SNW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bx42, SKIP, Prp45, SKIIP, PRPF45, NCOA-62

UniProt

Q13573

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNW1 Rabbit Polyclonal Antibody (orb588481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036377.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP64 Protein Vector (Human) (pPB-N-His)
PV047178 500 ng

ZFP64 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human Neurturin (Histidine-tagged) CF
387-NE-025/CF 25 µg

Recombinant Human Neurturin (Histidine-tagged) CF

Sign In for Pricing
View Details
Odf3b sgRNA CRISPR Lentivector set (Rat)
K6195301 3x 1.0 µg

Odf3b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
FRMD8 Protein Lysate (Human) with C-Ha Tag
20959031 100 µg

FRMD8 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Anti-BAFF/TNFSF13B Antibody Picoband® Fluoro488 Conjugated
PB9567-Fluoro488 100 µg/Vial

Anti-BAFF/TNFSF13B Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal RNF144A Antibody
NBP2-94282-0.02mL 0.02 mL

Rabbit Polyclonal RNF144A Antibody

Sign In for Pricing
View Details