Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNW1 Peptide - C-terminal region

SNW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bx42, SKIP, Prp45, SKIIP, PRPF45, NCOA-62

UniProt

Q13573

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNW1 Rabbit Polyclonal Antibody (orb588481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036377.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin, ID (Actin, cytoplasmic 1, Beta-actin, Actin, alpha cardiac muscle 1, Alpha-cardiac actin, ACTC1, ACTB/ACTC) (FITC) discontinued
A0760-41N-FITC 200 µL

Actin, ID (Actin, cytoplasmic 1, Beta-actin, Actin, alpha cardiac muscle 1, Alpha-cardiac actin, ACTC1, ACTB/ACTC) (FITC) discontinued

Sign In for Pricing
View Details
OR56A3 Antibody - C-terminal region
ARP71326_P050-25UL 25 µL

OR56A3 Antibody - C-terminal region

Sign In for Pricing
View Details
PRNPIP (F-10) Alexa Fluor® 488
sc-514310 AF488 200 µg/mL

PRNPIP (F-10) Alexa Fluor® 488

Sign In for Pricing
View Details
mmu-miR-1983 miRNA Antagomir
MNM01431 2x 5.0 nmol

mmu-miR-1983 miRNA Antagomir

Sign In for Pricing
View Details
Anti-Human CDS2 Polyclonal Antibody
HF842014-01 50 µg

Anti-Human CDS2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CDS2 Polyclonal Antibody
HF842014-02 100 µg

Anti-Human CDS2 Polyclonal Antibody

Sign In for Pricing
View Details