Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNW1 Peptide - C-terminal region

SNW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bx42, SKIP, Prp45, SKIIP, PRPF45, NCOA-62

UniProt

Q13573

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNW1 Rabbit Polyclonal Antibody (orb588481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036377.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Methylhydroxylamine hydrochloride
44122644-01 5 g

N-Methylhydroxylamine hydrochloride

Sign In for Pricing
View Details
N-Methylhydroxylamine hydrochloride
44122644-02 25 g

N-Methylhydroxylamine hydrochloride

Sign In for Pricing
View Details
ZNF239 (Zinc Finger Protein 239)
496301 100 µL

ZNF239 (Zinc Finger Protein 239)

Sign In for Pricing
View Details
Rabbit Monoclonal TRPV5 Antibody (SR2284)
NBP3-22511-100ul 100 µL

Rabbit Monoclonal TRPV5 Antibody (SR2284)

Sign In for Pricing
View Details
TSKS ORF Vector (Human) (pORF)
ORF035185 1.0 µg DNA

TSKS ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human Nestin (NES) Elisa Kit
EK713120 96 Well

Human Nestin (NES) Elisa Kit

Sign In for Pricing
View Details