Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNW1 Peptide - C-terminal region

SNW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bx42, SKIP, Prp45, SKIIP, PRPF45, NCOA-62

UniProt

Q13573

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNW1 Rabbit Polyclonal Antibody (orb588481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036377.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Replication protein A 70 kDa DNA-binding subunit (RPA1) ELISA Kit
RK13609 96 Tests

Mouse Replication protein A 70 kDa DNA-binding subunit (RPA1) ELISA Kit

Sign In for Pricing
View Details
Olfr263 (NM_010984) Mouse Untagged Clone
MC209092 10 µg

Olfr263 (NM_010984) Mouse Untagged Clone

Sign In for Pricing
View Details
LOC100361087 Protein Vector (Rat) (pPM-C-His)
PV278017 500 ng

LOC100361087 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
ITGAL Monoclonal Antibody, FITC Conjugated
CSB-MA120024 100 µL

ITGAL Monoclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Trypsin 1:250
T-161-25-100g 100 g

Trypsin 1:250

Sign In for Pricing
View Details
PADI4 siRNA (h)
sc-61283 10 µM

PADI4 siRNA (h)

Sign In for Pricing
View Details