RTF1 Peptide - middle region
RTF1 Peptide - middle region
Product Specifications
Product Name Alternative
GTL7, KIAA0252
UniProt
Q92541
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RTF1 Rabbit Polyclonal Antibody (orb588486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055953.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-H1101 96 Tests
ELISA kit for Human FOXO3 (Forkhead Box Protein O3)
Sign In for Pricing
View Details