Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTF1 Peptide - middle region

RTF1 Peptide - middle region

Product Specifications

Product Name Alternative

GTL7, KIAA0252

UniProt

Q92541

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTF1 Rabbit Polyclonal Antibody (orb588486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055953.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein G Magnetic Beads
HY-K0204-01 1 mL

Protein G Magnetic Beads

Sign In for Pricing
View Details
Protein G Magnetic Beads
HY-K0204-02 5 mL

Protein G Magnetic Beads

Sign In for Pricing
View Details
4-Chloro-5-aminopyrimidine ≥95% (HPLC)
233051-01 1 g

4-Chloro-5-aminopyrimidine ≥95% (HPLC)

Sign In for Pricing
View Details
4-Chloro-5-aminopyrimidine ≥95% (HPLC)
233051-02 5 g

4-Chloro-5-aminopyrimidine ≥95% (HPLC)

Sign In for Pricing
View Details
4-Chloro-5-aminopyrimidine ≥95% (HPLC)
233051-03 10 g

4-Chloro-5-aminopyrimidine ≥95% (HPLC)

Sign In for Pricing
View Details
4-Chloro-5-aminopyrimidine ≥95% (HPLC)
233051-04 25 g

4-Chloro-5-aminopyrimidine ≥95% (HPLC)

Sign In for Pricing
View Details