Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTF1 Peptide - middle region

RTF1 Peptide - middle region

Product Specifications

Product Name Alternative

GTL7, KIAA0252

UniProt

Q92541

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTF1 Rabbit Polyclonal Antibody (orb588487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055953.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dtx4 Mouse qPCR Template Standard (NM_172442)
MK202076 1 Kit

Dtx4 Mouse qPCR Template Standard (NM_172442)

Sign In for Pricing
View Details
Sodium Hexafluorophosphate
TRC-S634310-10G 10 g

Sodium Hexafluorophosphate

Sign In for Pricing
View Details
FAM124A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV710018 1.0 µg DNA

FAM124A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Lentiviral human OTX2 shRNA (UAS) - Lentiviral human OTX2 shRNA (UAS, RFP) plasmid
GTR15144049 1 Vial

Lentiviral human OTX2 shRNA (UAS) - Lentiviral human OTX2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Bovine Gamma-Aminobutyric Acid Receptor Subunit Rho-1 (GABRR1) ELISA Kit
MBS9925971-01 48 Well

Bovine Gamma-Aminobutyric Acid Receptor Subunit Rho-1 (GABRR1) ELISA Kit

Sign In for Pricing
View Details
Bovine Gamma-Aminobutyric Acid Receptor Subunit Rho-1 (GABRR1) ELISA Kit
MBS9925971-02 96 Well

Bovine Gamma-Aminobutyric Acid Receptor Subunit Rho-1 (GABRR1) ELISA Kit

Sign In for Pricing
View Details