Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTF1 Peptide - middle region

RTF1 Peptide - middle region

Product Specifications

Product Name Alternative

GTL7, KIAA0252

UniProt

Q92541

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTF1 Rabbit Polyclonal Antibody (orb588487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055953.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DPP4/CD26 Recombinant Protein
PROTP27487-100ug 100 µg

Human DPP4/CD26 Recombinant Protein

Sign In for Pricing
View Details
Rat Casein kinase I isoform gamma-1 (CSNK1G1) ELISA Kit
MBS7201655-01 48 Well

Rat Casein kinase I isoform gamma-1 (CSNK1G1) ELISA Kit

Sign In for Pricing
View Details
Rat Casein kinase I isoform gamma-1 (CSNK1G1) ELISA Kit
MBS7201655-02 96 Well

Rat Casein kinase I isoform gamma-1 (CSNK1G1) ELISA Kit

Sign In for Pricing
View Details
Rat Casein kinase I isoform gamma-1 (CSNK1G1) ELISA Kit
MBS7201655-03 5x 96 Well

Rat Casein kinase I isoform gamma-1 (CSNK1G1) ELISA Kit

Sign In for Pricing
View Details
Rat Casein kinase I isoform gamma-1 (CSNK1G1) ELISA Kit
MBS7201655-04 10x 96 Well

Rat Casein kinase I isoform gamma-1 (CSNK1G1) ELISA Kit

Sign In for Pricing
View Details
GPX2 Polyclonal Antibody
orb1420475 100 µL

GPX2 Polyclonal Antibody

Sign In for Pricing
View Details