PLEKHG6 Peptide - N-terminal region
PLEKHG6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MyoGEF
UniProt
Q3KR16
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLEKHG6 Rabbit Polyclonal Antibody (orb588513) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001138328.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TKAHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSGLTIEKSWRELVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942065-100 1x 100 µL
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2065), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881200-100 1x 100 µL
EGFR (GFR1195 + 31G7), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681671-100 1x 100 µL
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details