Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHG6 Peptide - N-terminal region

PLEKHG6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MyoGEF

UniProt

Q3KR16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHG6 Rabbit Polyclonal Antibody (orb588513) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138328.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKAHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSGLTIEKSWRELVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSF Antibody
KC-7939-01 50 μL

CTSF Antibody

Sign In for Pricing
View Details
CTSF Antibody
KC-7939-02 100 µL

CTSF Antibody

Sign In for Pricing
View Details
CTSF Antibody
KC-7939-03 1 mL

CTSF Antibody

Sign In for Pricing
View Details
SRC pTyr215 Rabbit Polyclonal Antibody
AP12713PU-N 400 µL

SRC pTyr215 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRELP (NM_002725) Human Over-expression Lysate
LY400959 100 µg

PRELP (NM_002725) Human Over-expression Lysate

Sign In for Pricing
View Details
KDM1A Antibody
OC-271-01 50 μL

KDM1A Antibody

Sign In for Pricing
View Details