Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCC1 Peptide - N-terminal region

GCC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GCC1P, GCC88

UniProt

Q96CN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCC1 Rabbit Polyclonal Antibody (orb588526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078799

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDTAASLTSTKGEFGVEDDRPARGPPPPKSEEASWSESGVSSSSGDGPFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp280c CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
50900154 3x 1.0 µg DNA

Zfp280c CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Recombinant Human PSME3/ PA28-gamma Protein, GST, E.coli-500ug
QP8770-ec-500ug 500ug

Recombinant Human PSME3/ PA28-gamma Protein, GST, E.coli-500ug

Sign In for Pricing
View Details
C4orf14 (NOA1) (NM_032313) Human Tagged ORF Clone
RC201000 10 µg

C4orf14 (NOA1) (NM_032313) Human Tagged ORF Clone

Sign In for Pricing
View Details
T-box Brain Protein 1 (TBR1, T-box Brain 1, T-brain-1) (APC) discontinued
T1848-23-APC 100 µL

T-box Brain Protein 1 (TBR1, T-box Brain 1, T-brain-1) (APC) discontinued

Sign In for Pricing
View Details
Human Glutamate--cysteine ligase catalytic subunit ELISA Kit
EK3336 Inquire

Human Glutamate--cysteine ligase catalytic subunit ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG H&L (Cy3), 1 pack = 100 µL
BAL6128 1 Each

Goat Anti-Rabbit IgG H&L (Cy3), 1 pack = 100 µL

Sign In for Pricing
View Details