SLTM Peptide - middle region
SLTM Peptide - middle region
Product Specifications
Product Name Alternative
Met
UniProt
Q9NWH9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLTM Rabbit Polyclonal Antibody (orb588531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079031
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HGQLISVEKVKGDPSKKEMKKENDEKSSSRSSGDKKNTSDRSSKTQASVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
APRab06249-01 20 µL
PARP-1 (Acetyl-K521) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab06249-02 50 µL
PARP-1 (Acetyl-K521) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab06249-03 100 µL
PARP-1 (Acetyl-K521) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab06249-04 200 µL
PARP-1 (Acetyl-K521) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
GTR15260495 1 Vial
Lentiviral mouse Aldh3b1 shRNA (UAS) - Lentiviral mouse Aldh3b1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details