SLTM Peptide - middle region
SLTM Peptide - middle region
Product Specifications
Product Name Alternative
Met
UniProt
Q9NWH9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLTM Rabbit Polyclonal Antibody (orb588531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079031
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HGQLISVEKVKGDPSKKEMKKENDEKSSSRSSGDKKNTSDRSSKTQASVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1601850-01 48 Well
Chicken Zinc finger CCCH domain-containing protein 15, ZC3H15 ELISA Kit
Sign In for Pricing
View Details MBS1601850-02 96 Well
Chicken Zinc finger CCCH domain-containing protein 15, ZC3H15 ELISA Kit
Sign In for Pricing
View Details MBS1601850-03 5x 96 Well
Chicken Zinc finger CCCH domain-containing protein 15, ZC3H15 ELISA Kit
Sign In for Pricing
View Details