Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription regulator protein BACH2 (BACH2), partial

Product Specifications

Product Name Alternative

(BTB and CNC homolog 2)

Abbreviation

Recombinant Human BACH2 protein, partial

Gene Name

BACH2

UniProt

Q9BYV9

Expression Region

618-770aa

Organism

Homo sapiens (Human)

Target Sequence

PVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Transcriptional regulator that acts as repressor or activator. Binds to Maf recognition elements (MARE) . Plays an important role in coordinating transcription activation and repression by MAFK. Induces apoptosis in response to oxidative stress through repression of the antiapoptotic factor HMOX1. Positively regulates the nuclear import of actin. Is a key regulator of adaptive immunity, crucial for the maintenance of regulatory T-cell function and B-cell maturation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.5 kDa

References & Citations

"BACH2 immunodeficiency illustrates an association between super-enhancers and haploinsufficiency." Afzali B., Groenholm J., Vandrovcova J., O'Brien C., Sun H.W., Vanderleyden I., Davis F.P., Khoder A., Zhang Y., Hegazy A.N., Villarino A.V., Palmer I.W., Kaufman J., Watts N.R., Kazemian M., Kamenyeva O., Keith J., Sayed A. Laurence A.D.J. Nat. Immunol. 18:813-823 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal PIAS2 Antibody (OTI2B5) [Alexa Fluor 488]
NBP2-73398AF488 0.1 mL

Mouse Monoclonal PIAS2 Antibody (OTI2B5) [Alexa Fluor 488]

Ask
View Details
Porcine Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody Pair Kit (with Standard)
MBS2099465-01 5x 96 Tests

Porcine Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody Pair Kit (with Standard)
MBS2099465-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Porcine Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody Pair Kit (with Standard)
MBS2099465-03 10x 96 Tests

Porcine Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody Pair Kit (with Standard)
MBS2099465-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Porcine Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody Pair Kit (with Standard)

Ask
View Details
Lentiviral human TCP10L shRNA (UAS) - Lentiviral human TCP10L shRNA (UAS, iRFP) (25)
GTR15347489 1 Vial

Lentiviral human TCP10L shRNA (UAS) - Lentiviral human TCP10L shRNA (UAS, iRFP) (25)

Ask
View Details