CD14 Peptide - middle region
CD14 Peptide - middle region
Product Specifications
UniProt
P08571
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD14 Rabbit Polyclonal Antibody (orb589145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000582.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1483803 1.0 µg DNA
OPALIN sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
243291-Biotin 100 µL
AMBP (alpha-1-microglobulin/bikunin Precursor, EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI) (Biotin)
Sign In for Pricing
View Details