Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD14 Peptide - middle region

CD14 Peptide - middle region

Product Specifications

UniProt

P08571

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD14 Rabbit Polyclonal Antibody (orb589145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000582.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT1 Antibody, FITC conjugated
A23143-50UG 50 µg

GIT1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human H2BFS / Histone H2B type F-S Recombinant Protein
R0356h 1 Each

Human H2BFS / Histone H2B type F-S Recombinant Protein

Sign In for Pricing
View Details
Cald1 (NM_145575) Mouse Tagged ORF Clone Lentiviral Particle
MR208506L4V 200 µL

Cald1 (NM_145575) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LOC635339 Mouse siRNA Oligo Duplex (Locus ID 635339)
SR406994 1 Kit

LOC635339 Mouse siRNA Oligo Duplex (Locus ID 635339)

Sign In for Pricing
View Details
ELMOD2 Polyclonal Antibody
MBS9432051-01 0.05 mL

ELMOD2 Polyclonal Antibody

Sign In for Pricing
View Details
ELMOD2 Polyclonal Antibody
MBS9432051-02 0.1 mL

ELMOD2 Polyclonal Antibody

Sign In for Pricing
View Details