Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A3 Peptide - middle region

SLC39A3 Peptide - middle region

Product Specifications

Product Name Alternative

ZIP3, ZIP-3

UniProt

F5H385

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC39A3 Rabbit Polyclonal Antibody (orb589178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653165.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLA

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFNA53 Protein Vector (Human) (pPM-C-HA)
18073021 500 ng

DFNA53 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse LGI1 shRNA Plasmid
abx974921-01 150 µg

Mouse LGI1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse LGI1 shRNA Plasmid
abx974921-02 300 µg

Mouse LGI1 shRNA Plasmid

Sign In for Pricing
View Details
RNF43 (NM_017763) Human Tagged Lenti ORF Clone
RC214013L1 10 µg

RNF43 (NM_017763) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RGD1309708 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
39075066 1.0 µg DNA

RGD1309708 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Cynomolgus/Rhesus macaque TNFRSF7/CD27 Protein
RP02610-01 1000 μg

Recombinant Cynomolgus/Rhesus macaque TNFRSF7/CD27 Protein

Sign In for Pricing
View Details