SLC39A3 Peptide - middle region
SLC39A3 Peptide - middle region
Product Specifications
Product Name Alternative
ZIP3, ZIP-3
UniProt
F5H385
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC39A3 Rabbit Polyclonal Antibody (orb589178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_653165.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLA
More Discoveries
Explore Other Products
Browse additional items from our catalog
![SERPINB2 Mouse Monoclonal Antibody [Clone ID: OTI1G3]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
TA503926S 30 µL
SERPINB2 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
Sign In for Pricing
View Details ![N-[3-[[4- (Chloromethyl) benzoyl]amino][1,1'-biphenyl]-4-yl]carbamic Acid tert-Butyl Ester](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
165236 50 mg
N-[3-[[4- (Chloromethyl) benzoyl]amino][1,1'-biphenyl]-4-yl]carbamic Acid tert-Butyl Ester
Sign In for Pricing
View Details 
MBS1268051-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
PFDN2 cDNA Clone
Sign In for Pricing
View Details MBS1268051-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock
PFDN2 cDNA Clone
Sign In for Pricing
View Details 
TP304354M 100 µg
NT5C3L (NT5C3B) (NM_052935) Human Recombinant Protein
Sign In for Pricing
View Details