SLC39A13 Peptide - middle region
SLC39A13 Peptide - middle region
Product Specifications
Product Name Alternative
LZT-Hs9
UniProt
Q96H72
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC39A13 Rabbit Polyclonal Antibody (orb589181) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001121697.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![p114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: OTI6G8]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9087fa/imageurl/cf810295.webp)
CF810295 100 µg
p114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: OTI6G8]
Sign In for Pricing
View Details 
BNC941857-100 1x 100 µL
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
