Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNT2 Peptide - middle region

KCNT2 Peptide - middle region

Product Specifications

Product Name Alternative

SLICK, KCa4.2, SLO2.1

UniProt

Q3SY61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNT2 Rabbit Polyclonal Antibody (orb589210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001274748.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RREDNKNILLNPGPRYIMNSTDICFYINITKEENSAFKNQDQQRKSNVSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSR1 (TRAP alpha) mouse monoclonal antibody
orb2327814-01 25 µL

SSR1 (TRAP alpha) mouse monoclonal antibody

Sign In for Pricing
View Details
SSR1 (TRAP alpha) mouse monoclonal antibody
orb2327814-02 100 µL

SSR1 (TRAP alpha) mouse monoclonal antibody

Sign In for Pricing
View Details
TSHR Antibody (FITC)
orb240358-01 50 µg

TSHR Antibody (FITC)

Sign In for Pricing
View Details
TSHR Antibody (FITC)
orb240358-02 100 µg

TSHR Antibody (FITC)

Sign In for Pricing
View Details
BRP44L Antibody (C-term)
orb2996818-01 50 µL

BRP44L Antibody (C-term)

Sign In for Pricing
View Details
BRP44L Antibody (C-term)
orb2996818-02 100 µL

BRP44L Antibody (C-term)

Sign In for Pricing
View Details