Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNT2 Peptide - middle region

KCNT2 Peptide - middle region

Product Specifications

Product Name Alternative

SLICK, KCa4.2, SLO2.1

UniProt

Q3SY61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNT2 Rabbit Polyclonal Antibody (orb589210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001274748.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RREDNKNILLNPGPRYIMNSTDICFYINITKEENSAFKNQDQQRKSNVSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVT6 Antibody
orb844732 2 mg

AVT6 Antibody

Sign In for Pricing
View Details
CIPC Antibody
orb37760-01 50 µg

CIPC Antibody

Sign In for Pricing
View Details
CIPC Antibody
orb37760-02 100 µg

CIPC Antibody

Sign In for Pricing
View Details
Mortar and Pestle 51mm
CR211211300 1 Each

Mortar and Pestle 51mm

Sign In for Pricing
View Details
WTX Rabbit pAb, PE-Cy5 conjugated
orb2859352 100 µL

WTX Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
(��R) -Hydroxy-benzenebutanoic Acid
167232 250 mg

(��R) -Hydroxy-benzenebutanoic Acid

Sign In for Pricing
View Details