KANSL3 Peptide - middle region
KANSL3 Peptide - middle region
Product Specifications
Product Name Alternative
NSL3, Rcd1, KIAA1310
UniProt
Q9P2N6
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KANSL3 Rabbit Polyclonal Antibody (orb589211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001108488.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VDRCIQDEIVDFLTGVLTRAEGHMGSEPRDQDAEKKKKPRDVARRDLAFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TYD-01152-02 10 g
2,3,4,6-Tetra-O-acetyl-β-D-galactopyranosyl azide
Sign In for Pricing
View Details 
MBS6388199-01 0.1 mL
P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (HRP)
Sign In for Pricing
View Details MBS6388199-02 5x 0.1 mL
P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (HRP)
Sign In for Pricing
View Details