Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A4 Peptide - C-terminal region

SLC22A4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OCTN1

UniProt

Q9H015

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A4 Rabbit Polyclonal Antibody (orb589246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003050.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMETEENPKVLITA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4EBP2 (NM_004096) Human Recombinant Protein
TP308664 20 µg

EIF4EBP2 (NM_004096) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800269 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CD44v3 (Marker of Tumor Metastasis) (3G5), CF405S conjugate, 0.1mg/mL
BNC042429-500 1x 500 µL

CD44v3 (Marker of Tumor Metastasis) (3G5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), Biotin conjugate, 0.1mg/mL
BNCB1730-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CSNK1G1 activation kit by CRISPRa
GA110046 1 Kit

Human CSNK1G1 activation kit by CRISPRa

Sign In for Pricing
View Details
EnzyChrom™ Phospholipase D Assay Kit
EPPD-100 100 Tests

EnzyChrom™ Phospholipase D Assay Kit

Sign In for Pricing
View Details