Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A4 Peptide - C-terminal region

SLC22A4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OCTN1

UniProt

Q9H015

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A4 Rabbit Polyclonal Antibody (orb589246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003050.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMETEENPKVLITA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta glucuronidase (GUSB) (NM_000181) Human Over-expression Lysate
LY400064 100 µg

beta glucuronidase (GUSB) (NM_000181) Human Over-expression Lysate

Sign In for Pricing
View Details
Nup155 Mouse Gene Knockout Kit (CRISPR)
KN311346RB 1 Kit

Nup155 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SORBS2 Polyclonal Antibody
E-AB-19081-01 20 µL

SORBS2 Polyclonal Antibody

Sign In for Pricing
View Details
SORBS2 Polyclonal Antibody
E-AB-19081-02 60 µL

SORBS2 Polyclonal Antibody

Sign In for Pricing
View Details
SORBS2 Polyclonal Antibody
E-AB-19081-03 120 µL

SORBS2 Polyclonal Antibody

Sign In for Pricing
View Details
SORBS2 Polyclonal Antibody
E-AB-19081-04 200 µL

SORBS2 Polyclonal Antibody

Sign In for Pricing
View Details