Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRBC2 Peptide - middle region

TRBC2 Peptide - middle region

Product Specifications

Product Name Alternative

TCRBC2

UniProt

A0A0G2JPF7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRBC2 Rabbit Polyclonal Antibody (orb55790) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

ABC72383.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PRDX4 Protein, N-His
bs-101898P-01 20 µg

Recombinant Human PRDX4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PRDX4 Protein, N-His
bs-101898P-02 50 µg

Recombinant Human PRDX4 Protein, N-His

Sign In for Pricing
View Details
FAM47E Rabbit pAb, AE conjugated
orb2889730 100 µL

FAM47E Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Anti-Emerin EMD Antibody Picoband® (monoclonal, 5A10) (HRP Conjugate)
M00714-HRP 100 µg/Vial

Anti-Emerin EMD Antibody Picoband® (monoclonal, 5A10) (HRP Conjugate)

Sign In for Pricing
View Details
MANF Antibody
E30AC3390 100 µL

MANF Antibody

Sign In for Pricing
View Details
Olivetolic acid
orb1941130-01 1 ml x 10 mM (in DMSO)

Olivetolic acid

Sign In for Pricing
View Details