Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2 Peptide - middle region

C2 Peptide - middle region

Product Specifications

Product Name Alternative

CO2, ARMD14

UniProt

A0A0G2JK28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C2 Rabbit Polyclonal Antibody (orb589249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000054.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methadone (MaxLight 650)
M3010-02-ML650 100 µL

Methadone (MaxLight 650)

Sign In for Pricing
View Details
MED12/Trap230 Rabbit Polyclonal Antibody (AP)
orb956016 100 µL

MED12/Trap230 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
RBBP7 siRNA (Rat)
MBS8227801-01 15 nmol

RBBP7 siRNA (Rat)

Sign In for Pricing
View Details
RBBP7 siRNA (Rat)
MBS8227801-02 30 nmol

RBBP7 siRNA (Rat)

Sign In for Pricing
View Details
RBBP7 siRNA (Rat)
MBS8227801-03 5x 30 nmol

RBBP7 siRNA (Rat)

Sign In for Pricing
View Details
ERCC5 Peptide
DF3143-BP 1 mg

ERCC5 Peptide

Sign In for Pricing
View Details