Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2 Peptide - middle region

C2 Peptide - middle region

Product Specifications

Product Name Alternative

CO2, ARMD14

UniProt

A0A0G2JK28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C2 Rabbit Polyclonal Antibody (orb589249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000054.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Galectin 1 (GAL1), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026008 96 Tests

Multiplex Assay Kit for Galectin 1 (GAL1), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Chicken FE (Ferritin) ELISA Kit
MBS2500969-01 24 Tests

Chicken FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Chicken FE (Ferritin) ELISA Kit
MBS2500969-02 48 Tests

Chicken FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Chicken FE (Ferritin) ELISA Kit
MBS2500969-03 96 Tests

Chicken FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Chicken FE (Ferritin) ELISA Kit
MBS2500969-04 5x 96 Tests

Chicken FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Chicken FE (Ferritin) ELISA Kit
MBS2500969-05 10x 96 Tests

Chicken FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details