Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHBDF2 Peptide - middle region

RHBDF2 Peptide - middle region

Product Specifications

Product Name Alternative

TEC, TOC, TOCG, RHBDL5, RHBDL6, iRhom2

UniProt

Q6ZWP8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHBDF2 Rabbit Polyclonal Antibody (orb589254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005498.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVVGNWLNRSYRRSISSTVQRQLESFDSHRPYFTYWLTFVHVIITLLVIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD196 Monoclonal Antibody (PE Conjugated)
MBS2559143-01 20 Tests

Anti-Human CD196 Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Anti-Human CD196 Monoclonal Antibody (PE Conjugated)
MBS2559143-02 100 Tests

Anti-Human CD196 Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Anti-Human CD196 Monoclonal Antibody (PE Conjugated)
MBS2559143-03 2x 100 Tests

Anti-Human CD196 Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Anti-Human CD196 Monoclonal Antibody (PE Conjugated)
MBS2559143-04 10x 100 Tests

Anti-Human CD196 Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
EULS3 Antibody
orb788166 2 mg

EULS3 Antibody

Sign In for Pricing
View Details
PPFIA2 Rabbit Polyclonal Antibody (Fluoro647)
orb3095057 100 µg

PPFIA2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details