Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPX1 Peptide - middle region

GPX1 Peptide - middle region

Product Specifications

Product Name Alternative

GPXD, GSHPX1

UniProt

A0A087WUQ6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPX1 Rabbit Polyclonal Antibody (orb589255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000572.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F7 (NM_152846) Rat Tagged ORF Clone Lentiviral Particle
RR210297L4V 200 µL

F7 (NM_152846) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LIF Antibody
E30AC2824 100 µL

LIF Antibody

Sign In for Pricing
View Details
AGO2 Antibody
A49778-50UL 50 μL

AGO2 Antibody

Sign In for Pricing
View Details
SLC2A4 (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 4, GLUT4)
251740 100 µg

SLC2A4 (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 4, GLUT4)

Sign In for Pricing
View Details
Fam70b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
20090114 3x 1.0 µg

Fam70b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
KBTBD8 AAV Vector (Mouse) (CMV)
25321104 1 µg

KBTBD8 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details