Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPX1 Peptide - middle region

GPX1 Peptide - middle region

Product Specifications

Product Name Alternative

GPXD, GSHPX1

UniProt

A0A087WUQ6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPX1 Rabbit Polyclonal Antibody (orb589255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000572.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Cadherin 20 (CDH20) ELISA Kit
GTR10319609 96 Well

Canine Cadherin 20 (CDH20) ELISA Kit

Sign In for Pricing
View Details
Pro-neuregulin-1, membrane-bound isoform Rabbit Polyclonal Antibody (PE-Cy5)
orb893103 100 µL

Pro-neuregulin-1, membrane-bound isoform Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
ACOT12 antibody - middle region
MBS3210838-01 0.1 mL

ACOT12 antibody - middle region

Sign In for Pricing
View Details
ACOT12 antibody - middle region
MBS3210838-02 5x 0.1 mL

ACOT12 antibody - middle region

Sign In for Pricing
View Details
Anti-CD19/CD3 Antibody (Blinatumomab)
F2117-5 5 mg

Anti-CD19/CD3 Antibody (Blinatumomab)

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily, Member 9 (TNFRSF9/CD137/4-1BB) ELISA Kit
201-12-6586 96 Tests

Human Tumor Necrosis Factor Receptor Superfamily, Member 9 (TNFRSF9/CD137/4-1BB) ELISA Kit

Sign In for Pricing
View Details