Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTK Peptide - N-terminal region

FASTK Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAST

UniProt

Q14296

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FASTK Rabbit Polyclonal Antibody (orb589258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001245390.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPSPNSMLRVLLSAQTSPARLSGLLLIPPVQPCCLGPSKWGDRPVGGGPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-HSPC302
YF-PA26796 50 ul

anti-HSPC302

Sign In for Pricing
View Details
Recombinant Mouse DNMT1 Protein (His Tag)
PDEM100008-01 20 µg

Recombinant Mouse DNMT1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse DNMT1 Protein (His Tag)
PDEM100008-02 100 µg

Recombinant Mouse DNMT1 Protein (His Tag)

Sign In for Pricing
View Details
Aamdc (NM_001177945) Mouse Tagged ORF Clone
MG220811 10 µg

Aamdc (NM_001177945) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRMT61A Rabbit Polyclonal Antibody (Carrier-free)
orb3093316 100 µg

TRMT61A Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Human Plexin-C1 (PLXNC1) ELISA Kit
MBS281296-01 48 Tests

Human Plexin-C1 (PLXNC1) ELISA Kit

Sign In for Pricing
View Details