Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTK Peptide - N-terminal region

FASTK Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAST

UniProt

Q14296

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FASTK Rabbit Polyclonal Antibody (orb589258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001245390.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPSPNSMLRVLLSAQTSPARLSGLLLIPPVQPCCLGPSKWGDRPVGGGPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCP1 Antibody
A27357-50UG 50 µg

LCP1 Antibody

Sign In for Pricing
View Details
Rabbit Anti-FRAT1 Polyclonal Antibody
PAV1485 100 μL

Rabbit Anti-FRAT1 Polyclonal Antibody

Sign In for Pricing
View Details
IDH3B Rabbit pAb
A13742-01 20 µL

IDH3B Rabbit pAb

Sign In for Pricing
View Details
IDH3B Rabbit pAb
A13742-02 100 μL

IDH3B Rabbit pAb

Sign In for Pricing
View Details
IDH3B Rabbit pAb
A13742-03 500 μL

IDH3B Rabbit pAb

Sign In for Pricing
View Details
IDH3B Rabbit pAb
A13742-04 1000 μL

IDH3B Rabbit pAb

Sign In for Pricing
View Details