Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMC3 Peptide - middle region

EMC3 Peptide - middle region

Product Specifications

Product Name Alternative

POB, TMEM111

UniProt

Q9P0I2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMC3 Rabbit Polyclonal Antibody (orb589260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060917.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT18P4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1170505 3x 1.0 µg

KRT18P4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
NR1I2 Rabbit Polyclonal Antibody (Biotin)
orb2132573 100 µL

NR1I2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Dbp ORF Vector (Mouse) (pORF)
17690014 1.0 µg DNA

Dbp ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FGF-17 CRISPR Activation Plasmid (h2)
sc-405951-ACT-2 20 µg

FGF-17 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Fish Dicarbonyl/L-Xylulose Reductase (DCXR) ELISA Kit
MBS9914242 Inquire

Fish Dicarbonyl/L-Xylulose Reductase (DCXR) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YIHO Polyclonal Antibody
MBS7158933 Inquire

Rabbit anti-Escherichia coli (strain K12) YIHO Polyclonal Antibody

Sign In for Pricing
View Details