Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELL2 Peptide - middle region

RELL2 Peptide - middle region

Product Specifications

Product Name Alternative

C5orf16

UniProt

Q8NC24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RELL2 Rabbit Polyclonal Antibody (orb589271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123501.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIEKRYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pleiotrophin (PTN) ELISA Kit
MBS2703156-01 24 Strip Well

Mouse Pleiotrophin (PTN) ELISA Kit

Sign In for Pricing
View Details
Mouse Pleiotrophin (PTN) ELISA Kit
MBS2703156-02 48 Well

Mouse Pleiotrophin (PTN) ELISA Kit

Sign In for Pricing
View Details
Mouse Pleiotrophin (PTN) ELISA Kit
MBS2703156-03 96 Well

Mouse Pleiotrophin (PTN) ELISA Kit

Sign In for Pricing
View Details
Mouse Pleiotrophin (PTN) ELISA Kit
MBS2703156-04 5x 96 Well

Mouse Pleiotrophin (PTN) ELISA Kit

Sign In for Pricing
View Details
Mouse Pleiotrophin (PTN) ELISA Kit
MBS2703156-05 10x 96 Well

Mouse Pleiotrophin (PTN) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Radil shRNA (UAS) - Lentiviral mouse Radil shRNA (UAS, iRFP) (100)
GTR15250395 1 Vial

Lentiviral mouse Radil shRNA (UAS) - Lentiviral mouse Radil shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details