Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELL2 Peptide - middle region

RELL2 Peptide - middle region

Product Specifications

Product Name Alternative

C5orf16

UniProt

Q8NC24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RELL2 Rabbit Polyclonal Antibody (orb589271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123501.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIEKRYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Phenyldodecane
TRC-P465250-50MG 50 mg

5-Phenyldodecane

Sign In for Pricing
View Details
ARID1B Polyclonal Antibody
E-AB-66485-01 60 µL

ARID1B Polyclonal Antibody

Sign In for Pricing
View Details
ARID1B Polyclonal Antibody
E-AB-66485-02 120 µL

ARID1B Polyclonal Antibody

Sign In for Pricing
View Details
ARID1B Polyclonal Antibody
E-AB-66485-03 200 µL

ARID1B Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS713454 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
UBE2T Recombinant Rabbit Monoclonal Antibody [JE65-79]
HA721385 100 µL

UBE2T Recombinant Rabbit Monoclonal Antibody [JE65-79]

Sign In for Pricing
View Details