Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC4A8 Peptide - N-terminal region

SLC4A8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NBC3, NDCBE

UniProt

Q2Y0W8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC4A8 Rabbit Polyclonal Antibody (orb589272) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035049.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitroso Phenylephrine
TRC-N542060-500MG 500 mg

N-Nitroso Phenylephrine

Sign In for Pricing
View Details
MultiTherm Touch Vortex Mixer, 100-240V with US cord
H5100-HCT 1 Each

MultiTherm Touch Vortex Mixer, 100-240V with US cord

Sign In for Pricing
View Details
Human IL-1 beta Recombinant Rabbit Monoclonal Antibody [PS00-82] - BSA and Azide free (Detector)
HA721279 100 µL

Human IL-1 beta Recombinant Rabbit Monoclonal Antibody [PS00-82] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Mouse Gm26504 activation kit by CRISPRa
GA206448 1 Kit

Mouse Gm26504 activation kit by CRISPRa

Sign In for Pricing
View Details
Roxindole Hydrochloride
TRC-R700858-25MG 25 mg

Roxindole Hydrochloride

Sign In for Pricing
View Details
RCOR3 Polyclonal Antibody
E-AB-19039-01 20 µL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details