CCAR1 Peptide - middle region
CCAR1 Peptide - middle region
Product Specifications
UniProt
H0YFJ7
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCAR1 Rabbit Polyclonal Antibody (orb589279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001269888.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DERKKEDKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6395704-01 0.1 mL
SV2B (Synaptic Vesicle Glycoprotein 2B, HsT19680, KIAA0735) (MaxLight 550)
Sign In for Pricing
View Details MBS6395704-02 5x 0.1 mL
SV2B (Synaptic Vesicle Glycoprotein 2B, HsT19680, KIAA0735) (MaxLight 550)
Sign In for Pricing
View Details 
