Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCAR1 Peptide - middle region

CCAR1 Peptide - middle region

Product Specifications

UniProt

H0YFJ7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCAR1 Rabbit Polyclonal Antibody (orb589279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001269888.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DERKKEDKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100364766 3'UTR GFP Stable Cell Line
TU259242 1.0 mL

LOC100364766 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
4-Amino-3-chloro-5-nitropyridine
430222-01 25 mg

4-Amino-3-chloro-5-nitropyridine

Sign In for Pricing
View Details
4-Amino-3-chloro-5-nitropyridine
430222-02 50 mg

4-Amino-3-chloro-5-nitropyridine

Sign In for Pricing
View Details
XRCC6 Protein Vector (Human) (pPB-N-His)
PV046630 500 ng

XRCC6 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rat Smim11 Pre-designed siRNA Set B
SI213356B 1 Each

Rat Smim11 Pre-designed siRNA Set B

Sign In for Pricing
View Details
RAB39A Polyclonal Antibody
MBS8567181-01 0.1 mL

RAB39A Polyclonal Antibody

Sign In for Pricing
View Details