Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRC1 Peptide - middle region

PRC1 Peptide - middle region

Product Specifications

Product Name Alternative

ASE1

UniProt

H0YL53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRC1 Rabbit Polyclonal Antibody (orb589284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001254509.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TMEM79 shRNA (UAS) - Lentiviral human TMEM79 shRNA (UAS, RFP) (100)
GTR15304743 1 Vial

Lentiviral human TMEM79 shRNA (UAS) - Lentiviral human TMEM79 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
TP53 Antibody
E220005-1 50 µg - 50 µL

TP53 Antibody

Sign In for Pricing
View Details
Anti-DTNBP1 antibody
STJ119020 100 µl

Anti-DTNBP1 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal JIP2 Antibody
NBP1-89638-25ul 25 µL

Rabbit Polyclonal JIP2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal anti-human VE-Cadherin (Cadherin-5)
hAP-0012 100 µg

Mouse Monoclonal anti-human VE-Cadherin (Cadherin-5)

Sign In for Pricing
View Details
Mouse anti Human CD11a, conjugated with PE
11A4 100 Tests

Mouse anti Human CD11a, conjugated with PE

Sign In for Pricing
View Details