PRC1 Peptide - middle region
PRC1 Peptide - middle region
Product Specifications
Product Name Alternative
ASE1
UniProt
H0YL53
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRC1 Rabbit Polyclonal Antibody (orb589284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001254509.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
457327-01 5 mg
N- (6-Amino-1,2,3,4-tetrahydro-1,3-dimethyl-2,4-dioxo-5-pyrimidinyl) -N-methylformamide
Sign In for Pricing
View Details 457327-02 25 mg
N- (6-Amino-1,2,3,4-tetrahydro-1,3-dimethyl-2,4-dioxo-5-pyrimidinyl) -N-methylformamide
Sign In for Pricing
View Details 
MBS6401288-01 0.1 mL
MTHFD2 (NMDMC, Bifunctional Methylenetetrahydrofolate Dehydrogenase/Cyclohydrolase, Mitochondrial, NAD-dependent Methylenetetrahydrofolate Dehydrogenase, Methenyltetrahydrofolate Cyclohydrolase) (FITC)
Sign In for Pricing
View Details MBS6401288-02 5x 0.1 mL
MTHFD2 (NMDMC, Bifunctional Methylenetetrahydrofolate Dehydrogenase/Cyclohydrolase, Mitochondrial, NAD-dependent Methylenetetrahydrofolate Dehydrogenase, Methenyltetrahydrofolate Cyclohydrolase) (FITC)
Sign In for Pricing
View Details 
GTR15104957 1 Vial
Lentiviral human MNT shRNA (UAS) - Lentiviral human MNT shRNA (UAS) (25)
Sign In for Pricing
View Details 