Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX4 Peptide - middle region

SNX4 Peptide - middle region

Product Specifications

Product Name Alternative

ATG24B

UniProt

O95219

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX4 Rabbit Polyclonal Antibody (orb588362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003785.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRVKNPDKRFTDLKHYSDELQSVISHLLRVRARVADRLYGVYKVHGNYGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNMT Antibody
MBS9608030-01 0.1 mL

PNMT Antibody

Sign In for Pricing
View Details
PNMT Antibody
MBS9608030-02 0.2 mL

PNMT Antibody

Sign In for Pricing
View Details
PNMT Antibody
MBS9608030-03 5x 0.2 mL

PNMT Antibody

Sign In for Pricing
View Details
Cypt2-ps Protein Vector (Mouse) (pPB-N-His)
PV169859 500 ng

Cypt2-ps Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2142221-01 0.1 mL

FITC-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2142221-02 0.2 mL

FITC-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details